SCOPe 2.03: Domain d3n8ha_: 3n8h A:

Lineage for d3n8ha_ (3n8h A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (31 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [196438] (2 PDB entries)

8. Domain d3n8ha_: 3n8h A: [199939]
   automated match to d3n8hb_
   complexed with acy, amp, gol, pro

Details for d3n8ha_

PDB Entry: 3n8h, 2 Å

PDB Description: crystal structure of pantoate-beta-alanine ligase from francisella tularensis

PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3n8ha_:

Sequence; same for both SEQRES and ATOM records:

>d3n8ha_ c.26.1.0 (A:) automated matches {Francisella tularensis [TaxId: 177416]}
amiiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnpt
qfnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegk
srpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqp
sglplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrif
lafyigkvrlidnflketgpsc

Timeline for d3n8ha_:

• d3n8ha_ is new in SCOPe 2.03-stable
  
• d3n8ha_ appears in SCOPe 2.04
  
• d3n8ha_ appears in the current release, SCOPe 2.08, called d3n8ha1