Lineage for d3n3ka_ (3n3k A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927329Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
    Pfam PF00443
  6. 2927409Protein Ubiquitin carboxyl-terminal hydrolase 8 [142858] (1 species)
  7. 2927410Species Human (Homo sapiens) [TaxId:9606] [142859] (2 PDB entries)
    Uniprot P40818 762-1109
  8. 2927412Domain d3n3ka_: 3n3k A: [199930]
    Other proteins in same PDB: d3n3kb_
    automated match to d2gfoa1
    complexed with zn

Details for d3n3ka_

PDB Entry: 3n3k (more details), 2.6 Å

PDB Description: the catalytic domain of usp8 in complex with a usp8 specific inhibitor
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 8

SCOPe Domain Sequences for d3n3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n3ka_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]}
rlsasqirnlnpvfggsgpaltglrnlgntcymnsilqclcnaphladyfnrncyqddin
rsnllghkgevaeefgiimkalwtgqyryispkdfkitigkindqfagysqqdsqelllf
lmdglhedlnkadnrkrykeenndhlddfkaaehawqkhkqlnesiivalfqgqfkstvq
cltchkksrtfeafmylslplastskctlqdclrlfskeekltdnnrfycshcrarrdsl
kkieiwklppvllvhlkrfsydgrwkqklqtsvdfplenldlsqyvigpknnlkkynlfs
vsnhyggldgghytaycknaarqrwfkfddhevsdisvssvkssaayilfytslg

SCOPe Domain Coordinates for d3n3ka_:

Click to download the PDB-style file with coordinates for d3n3ka_.
(The format of our PDB-style files is described here.)

Timeline for d3n3ka_: