Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins) Pfam PF00443 |
Protein Ubiquitin carboxyl-terminal hydrolase 8 [142858] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142859] (2 PDB entries) Uniprot P40818 762-1109 |
Domain d3n3ka_: 3n3k A: [199930] Other proteins in same PDB: d3n3kb_ automated match to d2gfoa1 complexed with zn |
PDB Entry: 3n3k (more details), 2.6 Å
SCOPe Domain Sequences for d3n3ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n3ka_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} rlsasqirnlnpvfggsgpaltglrnlgntcymnsilqclcnaphladyfnrncyqddin rsnllghkgevaeefgiimkalwtgqyryispkdfkitigkindqfagysqqdsqelllf lmdglhedlnkadnrkrykeenndhlddfkaaehawqkhkqlnesiivalfqgqfkstvq cltchkksrtfeafmylslplastskctlqdclrlfskeekltdnnrfycshcrarrdsl kkieiwklppvllvhlkrfsydgrwkqklqtsvdfplenldlsqyvigpknnlkkynlfs vsnhyggldgghytaycknaarqrwfkfddhevsdisvssvkssaayilfytslg
Timeline for d3n3ka_: