SCOPe 2.06: Domain d3mxwl1: 3mxw L:1-107

Lineage for d3mxwl1 (3mxw L:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3mxwl1: 3mxw L:1-107 [199902]
   Other proteins in same PDB: d3mxwa_, d3mxwl2
   automated match to d1rhha1
   complexed with ca, so4, zn

Details for d3mxwl1

PDB Entry: 3mxw, 1.83 Å

PDB Description: Crystal structure Sonic hedgehog bound to the 5E1 fab fragment

PDB Compounds: (L:) 5E1 light chain

SCOPe Domain Sequences for d3mxwl1:

Sequence; same for both SEQRES and ATOM records:

>d3mxwl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqtpkfllvsagdkvtitckasqsvsndltwyqqkpgqspklliyyasnrytgvpd
rftgsgygtdftftistvqaedlavyfcqqdygspptfgggtkveik

Timeline for d3mxwl1:

• d3mxwl1 first appeared in SCOPe 2.03
  
• d3mxwl1 appears in SCOPe 2.05
  
• d3mxwl1 appears in SCOPe 2.07
  
• d3mxwl1 appears in the current release, SCOPe 2.08