Lineage for d1rvfl_ (1rvf L:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2022563Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2023085Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (40 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 2023151Domain d1rvfl_: 1rvf L: [19990]
    Other proteins in same PDB: d1rvf.1, d1rvf1_, d1rvf3_, d1rvfh_
    part of Fv 17-Ia
    protein/RNA complex

Details for d1rvfl_

PDB Entry: 1rvf (more details), 4 Å

PDB Description: fab complexed with intact human rhinovirus
PDB Compounds: (L:) fab 17-ia

SCOPe Domain Sequences for d1rvfl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvfl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qivltqspaimsafpgekvtitcsatssvnymhwfqqkpgtspklwiysssnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrssypitfgsgtkleikrada

SCOPe Domain Coordinates for d1rvfl_:

Click to download the PDB-style file with coordinates for d1rvfl_.
(The format of our PDB-style files is described here.)

Timeline for d1rvfl_: