Lineage for d1forh1 (1for H:1-120)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652671Domain d1forh1: 1for H:1-120 [19989]
    Other proteins in same PDB: d1forh2, d1forl1, d1forl2
    part of Fab 17-Ia

Details for d1forh1

PDB Entry: 1for (more details), 2.75 Å

PDB Description: structure determination of an fab fragment that neutralizes human rhinovirus and analysis of the fab-virus complex
PDB Compounds: (H:) igg2a-kappa 17-ia fab (heavy chain)

SCOP Domain Sequences for d1forh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1forh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qgqlqqsgaelvrpgssvkisckasgyafssfwvnwvkqrpgqglewigqiypgdgdnky
ngkfkgkatltadkssttaymqlysltsedsavyfcarsgnypyamdywgqgtsvtvssa

SCOP Domain Coordinates for d1forh1:

Click to download the PDB-style file with coordinates for d1forh1.
(The format of our PDB-style files is described here.)

Timeline for d1forh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1forh2