SCOP 1.71: Domain d1forh1: 1for H:1-120

Lineage for d1forh1 (1for H:1-120)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1forh1: 1for H:1-120 [19989]
   Other proteins in same PDB: d1forh2, d1forl1, d1forl2
   part of Fab 17-Ia

Details for d1forh1

PDB Entry: 1for, 2.75 Å

PDB Description: structure determination of an fab fragment that neutralizes human rhinovirus and analysis of the fab-virus complex

SCOP Domain Sequences for d1forh1:

Sequence; same for both SEQRES and ATOM records:

>d1forh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qgqlqqsgaelvrpgssvkisckasgyafssfwvnwvkqrpgqglewigqiypgdgdnky
ngkfkgkatltadkssttaymqlysltsedsavyfcarsgnypyamdywgqgtsvtvssa

Timeline for d1forh1:

• d1forh1 first appeared (with stable ids) in SCOP 1.55
  
• d1forh1 appears in SCOP 1.69
  
• d1forh1 appears in SCOP 1.73
  
• d1forh1 appears in the current release, SCOPe 2.08