Lineage for d1forl1 (1for L:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1289118Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (52 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 1289131Domain d1forl1: 1for L:1-107 [19988]
    Other proteins in same PDB: d1forh1, d1forh2, d1forl2
    part of Fab 17-Ia

Details for d1forl1

PDB Entry: 1for (more details), 2.75 Å

PDB Description: structure determination of an fab fragment that neutralizes human rhinovirus and analysis of the fab-virus complex
PDB Compounds: (L:) igg2a-kappa 17-ia fab (light chain)

SCOPe Domain Sequences for d1forl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1forl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qivltqspaimsafpgekvtitcsatssvnymhwfqqkpgtspklwiysssnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrssypitfgsgtkleikr

SCOPe Domain Coordinates for d1forl1:

Click to download the PDB-style file with coordinates for d1forl1.
(The format of our PDB-style files is described here.)

Timeline for d1forl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1forl2