SCOPe 2.01: Domain d1forl1: 1for L:1-107

Lineage for d1forl1 (1for L:1-107)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d1forl1: 1for L:1-107 [19988]
   Other proteins in same PDB: d1forh1, d1forh2, d1forl2
   part of Fab 17-Ia

Details for d1forl1

PDB Entry: 1for, 2.75 Å

PDB Description: structure determination of an fab fragment that neutralizes human rhinovirus and analysis of the fab-virus complex

PDB Compounds: (L:) igg2a-kappa 17-ia fab (light chain)

SCOPe Domain Sequences for d1forl1:

Sequence; same for both SEQRES and ATOM records:

>d1forl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qivltqspaimsafpgekvtitcsatssvnymhwfqqkpgtspklwiysssnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrssypitfgsgtkleikr

Timeline for d1forl1:

• d1forl1 first appeared (with stable ids) in SCOP 1.55
  
• d1forl1 appears in SCOP 1.75
  
• d1forl1 appears in SCOPe 2.02
  
• d1forl1 appears in the current release, SCOPe 2.08