SCOP 1.55: Domain d1forl1: 1for L:1-107

Lineage for d1forl1 (1for L:1-107)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 17-Ia (mouse), kappa L chain [48791] (2 PDB entries)

8. Domain d1forl1: 1for L:1-107 [19988]
   Other proteins in same PDB: d1forh2, d1forl2

Details for d1forl1

PDB Entry: 1for, 2.75 Å

PDB Description: structure determination of an fab fragment that neutralizes human rhinovirus and analysis of the fab-virus complex

SCOP Domain Sequences for d1forl1:

Sequence; same for both SEQRES and ATOM records:

>d1forl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 17-Ia (mouse), kappa L chain}
qivltqspaimsafpgekvtitcsatssvnymhwfqqkpgtspklwiysssnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrssypitfgsgtkleikr

Timeline for d1forl1:

• d1forl1 appears in SCOP 1.57
  
• d1forl1 appears in the current release, SCOPe 2.08