SCOP 1.73: Domain d1ncch1: 1ncc H:1-113

Lineage for d1ncch1 (1ncc H:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)

8. Domain d1ncch1: 1ncc H:1-113 [19987]
   Other proteins in same PDB: d1ncch2, d1nccl1, d1nccl2, d1nccn_
   part of Fab NC41
   complexed with ca, man, nag; mutant

Details for d1ncch1

PDB Entry: 1ncc, 2.5 Å

PDB Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface

PDB Compounds: (H:) igg2a-kappa nc41 fab (heavy chain)

SCOP Domain Sequences for d1ncch1:

Sequence; same for both SEQRES and ATOM records:

>d1ncch1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintntgepty
geefkgrfafsletsastanlqinnlknedtatffcargednfgslsdywgqgttvtvss

Timeline for d1ncch1:

• d1ncch1 first appeared (with stable ids) in SCOP 1.55
  
• d1ncch1 appears in SCOP 1.71
  
• d1ncch1 appears in SCOP 1.75
  
• d1ncch1 appears in the current release, SCOPe 2.08