Lineage for d3mg8d_ (3mg8 D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1679108Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1679109Protein automated matches [190509] (9 species)
    not a true protein
  7. 1679123Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (12 PDB entries)
  8. 1679134Domain d3mg8d_: 3mg8 D: [199846]
    Other proteins in same PDB: d3mg81_, d3mg82_, d3mg8a_, d3mg8b_, d3mg8c_, d3mg8e_, d3mg8f_, d3mg8g_, d3mg8h_, d3mg8i_, d3mg8j_, d3mg8k_, d3mg8l_, d3mg8m_, d3mg8n_, d3mg8o_, d3mg8p_, d3mg8q_, d3mg8s_, d3mg8t_, d3mg8u_, d3mg8v_, d3mg8w_, d3mg8x_, d3mg8y_, d3mg8z_
    automated match to d4eu2f_
    complexed with l3t, mes, mg

Details for d3mg8d_

PDB Entry: 3mg8 (more details), 2.59 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 16
PDB Compounds: (D:) Proteasome component PUP2

SCOPe Domain Sequences for d3mg8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg8d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d3mg8d_:

Click to download the PDB-style file with coordinates for d3mg8d_.
(The format of our PDB-style files is described here.)

Timeline for d3mg8d_: