Lineage for d3mg6d_ (3mg6 D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230590Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (14 PDB entries)
  8. 2230599Domain d3mg6d_: 3mg6 D: [199838]
    Other proteins in same PDB: d3mg61_, d3mg62_, d3mg6a_, d3mg6b_, d3mg6c_, d3mg6e_, d3mg6f_, d3mg6g_, d3mg6h_, d3mg6i_, d3mg6j_, d3mg6k_, d3mg6l_, d3mg6m_, d3mg6n_, d3mg6o_, d3mg6p_, d3mg6q_, d3mg6s_, d3mg6t_, d3mg6u_, d3mg6v_, d3mg6w_, d3mg6x_, d3mg6y_, d3mg6z_
    automated match to d4eu2f_
    complexed with lzt, mes, mg

Details for d3mg6d_

PDB Entry: 3mg6 (more details), 2.6 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 6
PDB Compounds: (D:) Proteasome component PUP2

SCOPe Domain Sequences for d3mg6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg6d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d3mg6d_:

Click to download the PDB-style file with coordinates for d3mg6d_.
(The format of our PDB-style files is described here.)

Timeline for d3mg6d_: