SCOPe 2.04: Domain d3mega1: 3meg A:1-429

Lineage for d3mega1 (3meg A:1-429)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (5 species)
   not a true protein

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [187165] (10 PDB entries)

8. Domain d3mega1: 3meg A:1-429 [199835]
   Other proteins in same PDB: d3mega2
   automated match to d1bqna2
   complexed with so4, t27

Details for d3mega1

PDB Entry: 3meg, 2.8 Å

PDB Description: hiv-1 k103n reverse transcriptase in complex with tmc278

PDB Compounds: (A:) p66 Reverse transcriptase

SCOPe Domain Sequences for d3mega1:

Sequence; same for both SEQRES and ATOM records:

>d3mega1 e.8.1.2 (A:1-429) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkknksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d3mega1:

• d3mega1 first appeared in SCOPe 2.03
  
• d3mega1 appears in SCOPe 2.05
  
• d3mega1 appears in the current release, SCOPe 2.08