Lineage for d3meea2 (3mee A:430-552)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139125Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2139176Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 2139177Species Hiv-1 m:b_hxb2r [TaxId:11706] [224897] (8 PDB entries)
  8. 2139185Domain d3meea2: 3mee A:430-552 [199834]
    Other proteins in same PDB: d3meea1, d3meeb_
    automated match to d1c1ba1
    complexed with so4, t27

Details for d3meea2

PDB Entry: 3mee (more details), 2.4 Å

PDB Description: hiv-1 reverse transcriptase in complex with tmc278
PDB Compounds: (A:) p66 Reverse transcriptase

SCOPe Domain Sequences for d3meea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3meea2 c.55.3.1 (A:430-552) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

SCOPe Domain Coordinates for d3meea2:

Click to download the PDB-style file with coordinates for d3meea2.
(The format of our PDB-style files is described here.)

Timeline for d3meea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3meea1
View in 3D
Domains from other chains:
(mouse over for more information)
d3meeb_