Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (26 species) not a true protein |
Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries) |
Domain d3meda2: 3med A:430-552 [199832] Other proteins in same PDB: d3meda1, d3medb_ automated match to d1bqna1 complexed with 65b, cl, so4 |
PDB Entry: 3med (more details), 2.5 Å
SCOPe Domain Sequences for d3meda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3meda2 c.55.3.0 (A:430-552) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd klv
Timeline for d3meda2: