| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
| Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
| Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species) |
| Species Hiv-1 m:b_hxb2r [TaxId:11706] [224897] (8 PDB entries) |
| Domain d3meca2: 3mec A:430-552 [199830] Other proteins in same PDB: d3meca1, d3mecb_ automated match to d1c1ba1 complexed with 65b, so4 |
PDB Entry: 3mec (more details), 2.3 Å
SCOPe Domain Sequences for d3meca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3meca2 c.55.3.1 (A:430-552) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klv
Timeline for d3meca2: