Lineage for d1ncah1 (1nca H:1-113)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102841Species Fab NC41 (mouse), kappa L chain [48790] (4 PDB entries)
  8. 102844Domain d1ncah1: 1nca H:1-113 [19983]
    Other proteins in same PDB: d1ncah2, d1ncal2, d1ncan_

Details for d1ncah1

PDB Entry: 1nca (more details), 2.5 Å

PDB Description: refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex

SCOP Domain Sequences for d1ncah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncah1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab NC41 (mouse), kappa L chain}
qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintntgepty
geefkgrfafsletsastanlqinnlknedtatffcargednfgslsdywgqgttvtvss

SCOP Domain Coordinates for d1ncah1:

Click to download the PDB-style file with coordinates for d1ncah1.
(The format of our PDB-style files is described here.)

Timeline for d1ncah1: