SCOPe 2.05: Domain d3mc0b1: 3mc0 B:1-115

Lineage for d3mc0b1 (3mc0 B:1-115)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225054] (7 PDB entries)

8. Domain d3mc0b1: 3mc0 B:1-115 [199823]
   Other proteins in same PDB: d3mc0a_, d3mc0b2, d3mc0c_, d3mc0d2
   automated match to d1d5zc1
   complexed with act

Details for d3mc0b1

PDB Entry: 3mc0, 2 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a Mouse T-cell Receptor beta Chain

PDB Compounds: (B:) Enterotoxin SEG

SCOPe Domain Sequences for d3mc0b1:

Sequence, based on SEQRES records:

>d3mc0b1 b.40.2.0 (B:1-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn
evktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltf

Sequence, based on observed residues (ATOM records):

>d3mc0b1 b.40.2.0 (B:1-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn
evktelentelannykgkkvdifgvpyfytciipksenfggccmyggltf

Timeline for d3mc0b1:

• d3mc0b1 first appeared in SCOPe 2.03
  
• d3mc0b1 appears in SCOPe 2.04
  
• d3mc0b1 appears in SCOPe 2.06
  
• d3mc0b1 appears in the current release, SCOPe 2.08