Lineage for d3ma7c2 (3ma7 C:186-279)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1763896Domain d3ma7c2: 3ma7 C:186-279 [199822]
    Other proteins in same PDB: d3ma7a1, d3ma7b_, d3ma7c1, d3ma7d_
    automated match to d1onqa1
    complexed with cd4, nag, plm

Details for d3ma7c2

PDB Entry: 3ma7 (more details), 2.29 Å

PDB Description: crystal structure of cardiolipin bound to mouse cd1d
PDB Compounds: (C:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3ma7c2:

Sequence, based on SEQRES records: (download)

>d3ma7c2 b.1.1.2 (C:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d3ma7c2 b.1.1.2 (C:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwyl
qatldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d3ma7c2:

Click to download the PDB-style file with coordinates for d3ma7c2.
(The format of our PDB-style files is described here.)

Timeline for d3ma7c2: