Lineage for d3ma7c1 (3ma7 C:7-185)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2183623Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2183624Protein automated matches [226842] (4 species)
    not a true protein
  7. 2183780Species Mouse (Mus musculus) [TaxId:10090] [224924] (33 PDB entries)
  8. 2183798Domain d3ma7c1: 3ma7 C:7-185 [199821]
    Other proteins in same PDB: d3ma7a2, d3ma7b_, d3ma7c2, d3ma7d_
    automated match to d1onqa2
    complexed with cd4, nag, plm

Details for d3ma7c1

PDB Entry: 3ma7 (more details), 2.29 Å

PDB Description: crystal structure of cardiolipin bound to mouse cd1d
PDB Compounds: (C:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3ma7c1:

Sequence, based on SEQRES records: (download)

>d3ma7c1 d.19.1.0 (C:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d3ma7c1 d.19.1.0 (C:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmdypieiqlsagcemypgsesflhvafqgkyvvrfwgts
wqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3ma7c1:

Click to download the PDB-style file with coordinates for d3ma7c1.
(The format of our PDB-style files is described here.)

Timeline for d3ma7c1: