![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
![]() | Species Fab NC41 (mouse), kappa L chain [48790] (4 PDB entries) |
![]() | Domain d1ncbl1: 1ncb L:1-108 [19980] Other proteins in same PDB: d1ncbh2, d1ncbl2, d1ncbn_ |
PDB Entry: 1ncb (more details), 2.5 Å
SCOP Domain Sequences for d1ncbl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncbl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab NC41 (mouse), kappa L chain} divmtqspkfmstsvgdrvtitckasqdvstavvwyqqkpgqspklliywastrhigvpd rfagsgsgtdytltissvqaedlalyycqqhysppwtfgggtkleikr
Timeline for d1ncbl1: