SCOP 1.55: Domain d1ncbl1: 1ncb L:1-108

Lineage for d1ncbl1 (1ncb L:1-108)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab NC41 (mouse), kappa L chain [48790] (4 PDB entries)

8. Domain d1ncbl1: 1ncb L:1-108 [19980]
   Other proteins in same PDB: d1ncbh2, d1ncbl2, d1ncbn_

Details for d1ncbl1

PDB Entry: 1ncb, 2.5 Å

PDB Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface

SCOP Domain Sequences for d1ncbl1:

Sequence; same for both SEQRES and ATOM records:

>d1ncbl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab NC41 (mouse), kappa L chain}
divmtqspkfmstsvgdrvtitckasqdvstavvwyqqkpgqspklliywastrhigvpd
rfagsgsgtdytltissvqaedlalyycqqhysppwtfgggtkleikr

Timeline for d1ncbl1:

• d1ncbl1 appears in SCOP 1.57
  
• d1ncbl1 appears in the current release, SCOPe 2.08