SCOP 1.69: Domain d2jelh1: 2jel H:1-113

Lineage for d2jelh1 (2jel H:1-113)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)

8. Domain d2jelh1: 2jel H:1-113 [19979]
   Other proteins in same PDB: d2jelh2, d2jell1, d2jell2, d2jelp_
   part of Fab JE142

Details for d2jelh1

PDB Entry: 2jel, 2.5 Å

PDB Description: jel42 fab/hpr complex

SCOP Domain Sequences for d2jelh1:

Sequence; same for both SEQRES and ATOM records:

>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlaqsgpelvrpgvsvkisckgsgytfttyamhwvkqshakslewiglistysgytny
nqkfkgkatmtvdkssstaymelarltsedsaiyycarvmgeqyfdvwgagttvivss

Timeline for d2jelh1:

• d2jelh1 first appeared (with stable ids) in SCOP 1.55
  
• d2jelh1 appears in SCOP 1.67
  
• d2jelh1 appears in SCOP 1.71
  
• d2jelh1 appears in the current release, SCOPe 2.08