Lineage for d3hfmh1 (3hfm H:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652917Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (22 PDB entries)
  8. 652941Domain d3hfmh1: 3hfm H:1-113 [19977]
    Other proteins in same PDB: d3hfmh2, d3hfml1, d3hfml2, d3hfmy_
    part of Fab HyHEL-10

Details for d3hfmh1

PDB Entry: 3hfm (more details), 3 Å

PDB Description: structure of an antibody-antigen complex. crystal structure of the hy/hel-10 fab-lysozyme complex
PDB Compounds: (H:) hyhel-10 igg1 fab (heavy chain)

SCOP Domain Sequences for d3hfmh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hfmh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsa

SCOP Domain Coordinates for d3hfmh1:

Click to download the PDB-style file with coordinates for d3hfmh1.
(The format of our PDB-style files is described here.)

Timeline for d3hfmh1: