SCOP 1.67: Domain d3hfml1: 3hfm L:1-108

Lineage for d3hfml1 (3hfm L:1-108)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)

8. Domain d3hfml1: 3hfm L:1-108 [19976]
   Other proteins in same PDB: d3hfmh1, d3hfmh2, d3hfml2, d3hfmy_
   part of Fab HyHEL-10

Details for d3hfml1

PDB Entry: 3hfm, 3 Å

PDB Description: structure of an antibody-antigen complex. crystal structure of the hy/hel-10 fab-lysozyme complex

SCOP Domain Sequences for d3hfml1:

Sequence; same for both SEQRES and ATOM records:

>d3hfml1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleikr

Timeline for d3hfml1:

• d3hfml1 first appeared (with stable ids) in SCOP 1.55
  
• d3hfml1 appears in SCOP 1.65
  
• d3hfml1 appears in SCOP 1.69
  
• d3hfml1 appears in the current release, SCOPe 2.08