SCOP 1.67: Domain d1c08b_: 1c08 B:

Lineage for d1c08b_ (1c08 B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (20 PDB entries)

8. Domain d1c08b_: 1c08 B: [19975]
   Other proteins in same PDB: d1c08a_, d1c08c_
   part of Fv HyHEL-10

Details for d1c08b_

PDB Entry: 1c08, 2.3 Å

PDB Description: crystal structure of hyhel-10 fv-hen lysozyme complex

SCOP Domain Sequences for d1c08b_:

Sequence; same for both SEQRES and ATOM records:

>d1c08b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

Timeline for d1c08b_:

• d1c08b_ first appeared (with stable ids) in SCOP 1.55
  
• d1c08b_ appears in SCOP 1.65
  
• d1c08b_ appears in SCOP 1.69
  
• d1c08b_ appears in the current release, SCOPe 2.08