Lineage for d1c08b_ (1c08 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52389Species Fab HyHEL-10 (mouse), kappa L chain [48788] (5 PDB entries)
  8. 52397Domain d1c08b_: 1c08 B: [19975]
    Other proteins in same PDB: d1c08c_

Details for d1c08b_

PDB Entry: 1c08 (more details), 2.3 Å

PDB Description: crystal structure of hyhel-10 fv-hen lysozyme complex

SCOP Domain Sequences for d1c08b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c08b_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-10 (mouse), kappa L chain}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOP Domain Coordinates for d1c08b_:

Click to download the PDB-style file with coordinates for d1c08b_.
(The format of our PDB-style files is described here.)

Timeline for d1c08b_: