Lineage for d3lkra1 (3lkr A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544955Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (15 PDB entries)
    Uniprot P30685 25-300
  8. 2544963Domain d3lkra1: 3lkr A:1-181 [199743]
    Other proteins in same PDB: d3lkra2, d3lkrb1, d3lkrb2
    automated match to d1xh3a2

Details for d3lkra1

PDB Entry: 3lkr (more details), 2 Å

PDB Description: Crystal Structure of HLA B*3501 in complex with influenza NP418 epitope from 2009 H1N1 swine origin strain
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOPe Domain Sequences for d3lkra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lkra1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d3lkra1:

Click to download the PDB-style file with coordinates for d3lkra1.
(The format of our PDB-style files is described here.)

Timeline for d3lkra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lkra2