Lineage for d1c08a_ (1c08 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102741Species Fab HyHEL-10 (mouse), kappa L chain [48788] (5 PDB entries)
  8. 102748Domain d1c08a_: 1c08 A: [19974]
    Other proteins in same PDB: d1c08c_

Details for d1c08a_

PDB Entry: 1c08 (more details), 2.3 Å

PDB Description: crystal structure of hyhel-10 fv-hen lysozyme complex

SCOP Domain Sequences for d1c08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c08a_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-10 (mouse), kappa L chain}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

SCOP Domain Coordinates for d1c08a_:

Click to download the PDB-style file with coordinates for d1c08a_.
(The format of our PDB-style files is described here.)

Timeline for d1c08a_: