SCOPe 2.03: Domain d3lf1a_: 3lf1 A:

Lineage for d3lf1a_ (3lf1 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [196452] (24 PDB entries)

8. Domain d3lf1a_: 3lf1 A: [199728]
   automated match to d3lf1b_
   complexed with cl, mn

Details for d3lf1a_

PDB Entry: 3lf1, 2.31 Å

PDB Description: apo structure of the short chain oxidoreductase q9hya2 from pseudomonas aeruginosa pao1 containing an atypical catalytic center

PDB Compounds: (A:) Short Chain OxidoReductase Q9HYA2

SCOPe Domain Sequences for d3lf1a_:

Sequence; same for both SEQRES and ATOM records:

>d3lf1a_ c.2.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ydlseavavvtggssgiglatvellleagaavafcardgerlraaesalrqrfpgarlfa
svcdvldalqvrafaeacertlgcasilvnnagqgrvstfaettdeawseelqlkffsvi
hpvraflpqlesradaaivcvnsllasqpephmvatsaaragvknlvrsmafefapkgvr
vngiliglvesgqwrrrfeareereldwaqwtaqlarnkqiplgrlgkpieaarailfla
splsayttgshidvsgglsrha

Timeline for d3lf1a_:

• d3lf1a_ is new in SCOPe 2.03-stable
  
• d3lf1a_ appears in SCOPe 2.04
  
• d3lf1a_ appears in the current release, SCOPe 2.08