Lineage for d3lbfb_ (3lbf B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894585Species Escherichia coli K-12 [TaxId:83333] [196426] (9 PDB entries)
  8. 2894592Domain d3lbfb_: 3lbf B: [199726]
    automated match to d3lbfd_
    complexed with gol, po4, sah

Details for d3lbfb_

PDB Entry: 3lbf (more details), 1.8 Å

PDB Description: crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli
PDB Compounds: (B:) protein-l-isoaspartate o-methyltransferase

SCOPe Domain Sequences for d3lbfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lbfb_ c.66.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vsrrvqalldqlraqgiqdeqvlnalaavprekfvdeafeqkawdnialpigqgqtisqp
ymvarmtelleltpqsrvleigtgsgyqtailahlvqhvcsverikglqwqarrrlknld
lhnvstrhgdgwqgwqarapfdaiivtaappeiptalmtqldeggilvlpvgeehqylkr
vrrrggefiidtveavrfvplvkgela

SCOPe Domain Coordinates for d3lbfb_:

Click to download the PDB-style file with coordinates for d3lbfb_.
(The format of our PDB-style files is described here.)

Timeline for d3lbfb_: