Lineage for d2iffl1 (2iff L:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2354190Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (42 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 2354202Domain d2iffl1: 2iff L:1-106 [19972]
    Other proteins in same PDB: d2iffh1, d2iffh2, d2iffl2, d2iffy_
    part of Fab HyHEL-5
    mutant

Details for d2iffl1

PDB Entry: 2iff (more details), 2.65 Å

PDB Description: structure of an antibody-lysozyme complex: effect of a conservative mutation
PDB Compounds: (L:) igg1 hyhel-5 fab (light chain)

SCOPe Domain Sequences for d2iffl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iffl1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvr
fsgsgsgtsysltissmetedaatyycqqwgrnptfgggtkleikr

SCOPe Domain Coordinates for d2iffl1:

Click to download the PDB-style file with coordinates for d2iffl1.
(The format of our PDB-style files is described here.)

Timeline for d2iffl1: