Lineage for d2iffl1 (2iff L:1-106)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7720Species Fab HyHEL-5 (mouse), kappa L chain [48787] (3 PDB entries)
  8. 7726Domain d2iffl1: 2iff L:1-106 [19972]
    Other proteins in same PDB: d2iffh2, d2iffl2, d2iffy_

Details for d2iffl1

PDB Entry: 2iff (more details), 2.65 Å

PDB Description: structure of an antibody-lysozyme complex: effect of a conservative mutation

SCOP Domain Sequences for d2iffl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iffl1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
divltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvr
fsgsgsgtsysltissmetedaatyycqqwgrnptfgggtkleikr

SCOP Domain Coordinates for d2iffl1:

Click to download the PDB-style file with coordinates for d2iffl1.
(The format of our PDB-style files is described here.)

Timeline for d2iffl1: