| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Fab HyHEL-5 (mouse), kappa L chain [48787] (3 PDB entries) |
| Domain d2iffl1: 2iff L:1-106 [19972] Other proteins in same PDB: d2iffh2, d2iffl2, d2iffy_ |
PDB Entry: 2iff (more details), 2.65 Å
SCOP Domain Sequences for d2iffl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iffl1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
divltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvr
fsgsgsgtsysltissmetedaatyycqqwgrnptfgggtkleikr
Timeline for d2iffl1: