SCOPe 2.03: Domain d3l75c2: 3l75 C:262-380

Lineage for d3l75c2 (3l75 C:262-380)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries)

8. Domain d3l75c2: 3l75 C:262-380 [199714]
   Other proteins in same PDB: d3l75c1, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75p1, d3l75s_, d3l75t_, d3l75u_, d3l75w_
   automated match to d1bccc2
   complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq

Details for d3l75c2

PDB Entry: 3l75, 2.79 Å

PDB Description: cytochrome bc1 complex from chicken with fenamidone bound

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3l75c2:

Sequence; same for both SEQRES and ATOM records:

>d3l75c2 f.32.1.1 (C:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

Timeline for d3l75c2:

• d3l75c2 is new in SCOPe 2.03-stable
  
• d3l75c2 appears in SCOPe 2.04
  
• d3l75c2 appears in the current release, SCOPe 2.08