Lineage for d3l74p2 (3l74 P:262-380)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1699388Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1699389Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 1699390Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1699391Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 1699399Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries)
  8. 1699403Domain d3l74p2: 3l74 P:262-380 [199712]
    Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74d1, d3l74d2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74q1, d3l74q2, d3l74s_, d3l74t_, d3l74u_, d3l74w_
    automated match to d1bccc2
    complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74p2

PDB Entry: 3l74 (more details), 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound
PDB Compounds: (P:) cytochrome b

SCOPe Domain Sequences for d3l74p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l74p2 f.32.1.1 (P:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

SCOPe Domain Coordinates for d3l74p2:

Click to download the PDB-style file with coordinates for d3l74p2.
(The format of our PDB-style files is described here.)

Timeline for d3l74p2: