![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
![]() | Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) ![]() |
![]() | Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries) |
![]() | Domain d3l74p2: 3l74 P:262-380 [199712] Other proteins in same PDB: d3l74c1, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74p1, d3l74s_, d3l74t_, d3l74u_, d3l74w_ automated match to d1bccc2 complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq |
PDB Entry: 3l74 (more details), 2.76 Å
SCOPe Domain Sequences for d3l74p2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l74p2 f.32.1.1 (P:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny
Timeline for d3l74p2: