| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
| Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
| Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
| Species Chicken (Gallus gallus) [TaxId:9031] [81639] (8 PDB entries) |
| Domain d3l74c1: 3l74 C:1-261 [199709] Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c2, d3l74d1, d3l74d2, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_ automated match to d1bccc3 complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq |
PDB Entry: 3l74 (more details), 2.76 Å
SCOPe Domain Sequences for d3l74c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l74c1 f.21.1.2 (C:1-261) Mitochondrial cytochrome b subunit, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mapnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadt
slafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvil
lltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrff
alhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpf
ltlalfspnllgdpenftpan
Timeline for d3l74c1:
View in 3DDomains from other chains: (mouse over for more information) d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74d1, d3l74d2, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_ |