SCOPe 2.08: Domain d3l74c1: 3l74 C:1-261

Lineage for d3l74c1 (3l74 C:1-261)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
   also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits

7. Species Chicken (Gallus gallus) [TaxId:9031] [81639] (8 PDB entries)

8. Domain d3l74c1: 3l74 C:1-261 [199709]
   Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c2, d3l74d1, d3l74d2, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_
   automated match to d1bccc3
   complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74c1

PDB Entry: 3l74, 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3l74c1:

Sequence; same for both SEQRES and ATOM records:

>d3l74c1 f.21.1.2 (C:1-261) Mitochondrial cytochrome b subunit, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mapnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadt
slafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvil
lltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrff
alhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpf
ltlalfspnllgdpenftpan

Timeline for d3l74c1:

• d3l74c1 first appeared in SCOPe 2.03
  
• d3l74c1 appears in SCOPe 2.07