SCOPe 2.04: Domain d3l71p2: 3l71 P:262-380

Lineage for d3l71p2 (3l71 P:262-380)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries)

8. Domain d3l71p2: 3l71 P:262-380 [199708]
   Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71d1, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71q1, d3l71q2, d3l71s_, d3l71t_, d3l71u_, d3l71w_
   automated match to d1bccc2
   complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71p2

PDB Entry: 3l71, 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound

PDB Compounds: (P:) cytochrome b

SCOPe Domain Sequences for d3l71p2:

Sequence; same for both SEQRES and ATOM records:

>d3l71p2 f.32.1.1 (P:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

Timeline for d3l71p2:

• d3l71p2 first appeared in SCOPe 2.03
  
• d3l71p2 appears in SCOPe 2.05
  
• d3l71p2 appears in the current release, SCOPe 2.08