Lineage for d3l71c2 (3l71 C:262-380)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1699388Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1699389Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 1699390Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1699391Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 1699399Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries)
  8. 1699404Domain d3l71c2: 3l71 C:262-380 [199706]
    Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71d1, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71q1, d3l71q2, d3l71s_, d3l71t_, d3l71u_, d3l71w_
    automated match to d1bccc2
    complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71c2

PDB Entry: 3l71 (more details), 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3l71c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l71c2 f.32.1.1 (C:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

SCOPe Domain Coordinates for d3l71c2:

Click to download the PDB-style file with coordinates for d3l71c2.
(The format of our PDB-style files is described here.)

Timeline for d3l71c2: