SCOPe 2.03: Domain d3l70p1: 3l70 P:2-261

Lineage for d3l70p1 (3l70 P:2-261)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
   also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits

7. Species Chicken (Gallus gallus) [TaxId:9031] [81639] (8 PDB entries)

8. Domain d3l70p1: 3l70 P:2-261 [199703]
   Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c2, d3l70d1, d3l70d2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p2, d3l70s_, d3l70t_, d3l70u_, d3l70w_
   automated match to d1bccc3
   complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70p1

PDB Entry: 3l70, 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound

PDB Compounds: (P:) cytochrome b

SCOPe Domain Sequences for d3l70p1:

Sequence; same for both SEQRES and ATOM records:

>d3l70p1 f.21.1.2 (P:2-261) Mitochondrial cytochrome b subunit, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
tlalfspnllgdpenftpan

Timeline for d3l70p1:

• d3l70p1 is new in SCOPe 2.03-stable
  
• d3l70p1 appears in SCOPe 2.04
  
• d3l70p1 appears in the current release, SCOPe 2.08