Lineage for d3l70c2 (3l70 C:262-380)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255813Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2255814Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2255815Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2255816Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 2255824Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries)
  8. 2255831Domain d3l70c2: 3l70 C:262-380 [199702]
    Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70d1, d3l70d2, d3l70e1, d3l70e2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70q1, d3l70q2, d3l70r1, d3l70r2, d3l70s_, d3l70t_, d3l70u_, d3l70w_
    automated match to d1bccc2
    complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70c2

PDB Entry: 3l70 (more details), 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3l70c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l70c2 f.32.1.1 (C:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

SCOPe Domain Coordinates for d3l70c2:

Click to download the PDB-style file with coordinates for d3l70c2.
(The format of our PDB-style files is described here.)

Timeline for d3l70c2: