SCOPe 2.03: Domain d3l70c2: 3l70 C:262-380

Lineage for d3l70c2 (3l70 C:262-380)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries)

8. Domain d3l70c2: 3l70 C:262-380 [199702]
   Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70d1, d3l70d2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70s_, d3l70t_, d3l70u_, d3l70w_
   automated match to d1bccc2
   complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70c2

PDB Entry: 3l70, 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3l70c2:

Sequence; same for both SEQRES and ATOM records:

>d3l70c2 f.32.1.1 (C:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

Timeline for d3l70c2:

• d3l70c2 is new in SCOPe 2.03-stable
  
• d3l70c2 appears in SCOPe 2.04
  
• d3l70c2 appears in the current release, SCOPe 2.08