SCOP 1.55: Domain d1bqll1: 1bql L:1-106

Lineage for d1bqll1 (1bql L:1-106)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab HyHEL-5 (mouse), kappa L chain [48787] (3 PDB entries)

8. Domain d1bqll1: 1bql L:1-106 [19970]
   Other proteins in same PDB: d1bqlh2, d1bqll2, d1bqly_

Details for d1bqll1

PDB Entry: 1bql, 2.6 Å

PDB Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme

SCOP Domain Sequences for d1bqll1:

Sequence; same for both SEQRES and ATOM records:

>d1bqll1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
divltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvr
fsgsgsgtsysltissmetedaatyycqqwgrnptfgggtkleikr

Timeline for d1bqll1:

• d1bqll1 appears in SCOP 1.57
  
• d1bqll1 appears in the current release, SCOPe 2.08