SCOP 1.69: Domain d3hflh1: 3hfl H:1-116

Lineage for d3hflh1 (3hfl H:1-116)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)

8. Domain d3hflh1: 3hfl H:1-116 [19969]
   Other proteins in same PDB: d3hflh2, d3hfll1, d3hfll2, d3hfly_
   part of Fab HyHEL-5

Details for d3hflh1

PDB Entry: 3hfl, 2.65 Å

PDB Description: the refined structure of the monoclonal antibody hy(slash)hel-5 with its antigen hen egg white lysozyme

SCOP Domain Sequences for d3hflh1:

Sequence; same for both SEQRES and ATOM records:

>d3hflh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstny
herfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvssakt

Timeline for d3hflh1:

• d3hflh1 first appeared (with stable ids) in SCOP 1.55
  
• d3hflh1 appears in SCOP 1.67
  
• d3hflh1 last appears in SCOP 1.71