SCOPe 2.08: Domain d3l49a1: 3l49 A:29-309

Lineage for d3l49a1 (3l49 A:29-309)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [196489] (1 PDB entry)

8. Domain d3l49a1: 3l49 A:29-309 [199689]
   Other proteins in same PDB: d3l49a2, d3l49b2, d3l49c2, d3l49d2
   automated match to d3l49d_
   complexed with unl

Details for d3l49a1

PDB Entry: 3l49, 2.3 Å

PDB Description: crystal structure of abc sugar transporter subunit from rhodobacter sphaeroides 2.4.1

PDB Compounds: (A:) ABC sugar (Ribose) transporter, periplasmic substrate-binding subunit

SCOPe Domain Sequences for d3l49a1:

Sequence; same for both SEQRES and ATOM records:

>d3l49a1 c.93.1.0 (A:29-309) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
legktigitaigtdhdwdlkayqaqiaeierlggtaialdagrndqtqvsqiqtliaqkp
daiieqlgnldvlnpwlqkindagiplftvdtatphainnttsnnysigaelalqmvadl
ggkgnvlvfngfysvpvckirydqmkyvleafpdvkiiepelrdvipntiqsaysnvtdm
ltkypnegdvgaiwacwdvpmigatqalqaagrtdirtygvdgspefvemvadpespaga
vaaqqpseigklavqnvarhlagqevkpftfapavlitken

Timeline for d3l49a1:

• d3l49a1 first appeared in SCOPe 2.03, called d3l49a_
  
• d3l49a1 appears in SCOPe 2.07