Lineage for d3kypc_ (3kyp C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242386Fold d.305: NAP-like [143112] (1 superfamily)
    core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix
  4. 2242387Superfamily d.305.1: NAP-like [143113] (2 families) (S)
  5. 2242400Family d.305.1.0: automated matches [196445] (1 protein)
    not a true family
  6. 2242401Protein automated matches [196446] (3 species)
    not a true protein
  7. 2242405Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [196447] (2 PDB entries)
  8. 2242414Domain d3kypc_: 3kyp C: [199683]
    automated match to d3kypf_

Details for d3kypc_

PDB Entry: 3kyp (more details), 2.8 Å

PDB Description: crystal structure of nucleosome assembly protein s (pfnaps) from plasmodium falciparum
PDB Compounds: (C:) Nucleosome assembly protein

SCOPe Domain Sequences for d3kypc_:

Sequence, based on SEQRES records: (download)

>d3kypc_ d.305.1.0 (C:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
whnplsyyl

Sequence, based on observed residues (ATOM records): (download)

>d3kypc_ d.305.1.0 (C:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
alsdivpedidilnhlvkldlkdnmdngsykitfifgekakefmepltlvkhvtqekvve
ctrikwkegknpiaifewfttdelqdkpdvgelirreiwhnplsyyl

SCOPe Domain Coordinates for d3kypc_:

Click to download the PDB-style file with coordinates for d3kypc_.
(The format of our PDB-style files is described here.)

Timeline for d3kypc_: