SCOP 1.73: Domain d1jhlh_: 1jhl H:

Lineage for d1jhlh_ (1jhl H:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1jhlh_: 1jhl H: [19967]
   Other proteins in same PDB: d1jhla_, d1jhll_
   part of Fv D11.15

Details for d1jhlh_

PDB Entry: 1jhl, 2.4 Å

PDB Description: three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex

PDB Compounds: (H:) igg1-kappa d11.15 fv (heavy chain)

SCOP Domain Sequences for d1jhlh_:

Sequence; same for both SEQRES and ATOM records:

>d1jhlh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsgaelvrpgasvklsckasgytfisywinwvkqrpgqglewigniypsdsytny
nqkfkdkatltvdkssstaymqlssptsedsavyyctrddnygamdywgqgttvtv

Timeline for d1jhlh_:

• d1jhlh_ first appeared (with stable ids) in SCOP 1.55
  
• d1jhlh_ appears in SCOP 1.71
  
• d1jhlh_ appears in SCOP 1.75
  
• d1jhlh_ appears in the current release, SCOPe 2.08, called d1jhlh1