SCOP 1.57: Domain d1jhlh_: 1jhl H:

Lineage for d1jhlh_ (1jhl H:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fv D11.15 (mouse), kappa L chain [48786] (1 PDB entry)

8. Domain d1jhlh_: 1jhl H: [19967]
   Other proteins in same PDB: d1jhla_

Details for d1jhlh_

PDB Entry: 1jhl, 2.4 Å

PDB Description: three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex

SCOP Domain Sequences for d1jhlh_:

Sequence; same for both SEQRES and ATOM records:

>d1jhlh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fv D11.15 (mouse), kappa L chain}
qvqlqqsgaelvrpgasvklsckasgytfisywinwvkqrpgqglewigniypsdsytny
nqkfkdkatltvdkssstaymqlssptsedsavyyctrddnygamdywgqgttvtv

Timeline for d1jhlh_:

• d1jhlh_ first appeared (with stable ids) in SCOP 1.55
  
• d1jhlh_ appears in SCOP 1.59
  
• d1jhlh_ appears in the current release, SCOPe 2.08, called d1jhlh1