Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fv D11.15 (mouse), kappa L chain [48786] (1 PDB entry) |
Domain d1jhlh_: 1jhl H: [19967] Other proteins in same PDB: d1jhla_ |
PDB Entry: 1jhl (more details), 2.4 Å
SCOP Domain Sequences for d1jhlh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jhlh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fv D11.15 (mouse), kappa L chain} qvqlqqsgaelvrpgasvklsckasgytfisywinwvkqrpgqglewigniypsdsytny nqkfkdkatltvdkssstaymqlssptsedsavyyctrddnygamdywgqgttvtv
Timeline for d1jhlh_: