Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries) |
Domain d3kqge1: 3kqg E:199-326 [199669] Other proteins in same PDB: d3kqga2, d3kqgb2, d3kqgc2, d3kqgd2, d3kqge2, d3kqgf2 complexed with ca |
PDB Entry: 3kqg (more details), 2.3 Å
SCOPe Domain Sequences for d3kqge1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kqge1 d.169.1.0 (E:199-326) automated matches {Human (Homo sapiens) [TaxId: 9606]} wkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltka gmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflfi ckrpyvps
Timeline for d3kqge1: